PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10027847
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family bZIP
Protein Properties Length: 293aa    MW: 31125.5 Da    PI: 5.86
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10027847genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_126.51.4e-0895139751
                  HHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   7 errkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                   +r   NReA r++R++Kka+ + Le++v +L a N++L  +l+ 
  Lus10027847  95 KKRPLGNREAVRKYREKKKARAASLEDEVVKLRAVNQQLMRRLQG 139
                  678888*********************************999874 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.0E-889156IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.2E-1292157No hitNo description
PfamPF077162.9E-1392146IPR004827Basic-leucine zipper domain
CDDcd146862.60E-1295148No hitNo description
SuperFamilySSF579598.75E-796139No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071294Biological Processcellular response to zinc ion
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MEDGEVEFSN QEVFSATNMA EFPSSGSMDS FFDELLKDTH ACTHTHTCNP PGPDYSHTHT  60
CFHVHTKIVS ASSGGSDGDD DGTSESAGKK LSSSKKRPLG NREAVRKYRE KKKARAASLE  120
DEVVKLRAVN QQLMRRLQGQ AALEAEVARL KCLLVDIRGR IEGEIGSFPY QKPVAAAAAA  180
NLNLSNMNGA YVMNPCDMQC NDQAYCLHPG MDGRSGSGGD GAGLNGNGQV YGGGSGGCDF  240
ENLQCMMNES SGAKDFSVCG VGNGVTNGIS PGSSKRKGYD EWQCPYVARA DL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ8879181e-85HQ887918.1 Linum usitatissimum clone GMU2AYZ01ACED6 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002534148.21e-138PREDICTED: uncharacterized protein LOC8266428 isoform X1
RefseqXP_015583847.11e-138PREDICTED: uncharacterized protein LOC8266428 isoform X2
SwissprotQ8GTS21e-100BZP23_ARATH; Basic leucine zipper 23
TrEMBLB9T7C91e-138B9T7C9_RICCO; DNA binding protein, putative
STRINGVIT_03s0038g02420.t011e-129(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25673277
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16770.12e-78bZIP family protein